Galectin 1 (LGALS1) (NM_002305) Human Mass Spec Standard

CAT#: PH304674

LGALS1 MS Standard C13 and N15-labeled recombinant protein (NP_002296)

Product Images

Coomassie blue staining of purified LGALS1 protein (Cat# TP304674). The protein was produced from HEK293T cells transfected with LGALS1 cDNA clone (Cat# RC204674) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204674
• Predicted MW: 14.7 kDa
• Protein Sequence:
  Sequence Link

  >RC204674 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWG
  TEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKIKCVAFD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002296
• RefSeq Size: 586
• RefSeq ORF: 405
• Synonyms: GAL1; GBP
• Locus ID: 3956
• UniProt ID: P09382, A0A384MR27
• Cytogenetics: 22q13.1
• Summary: 'The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. This gene product may act as an autocrine negative growth factor that regulates cell proliferation. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome