Antibodies

Jump to Filters
View as table Download
NR0B1 Rabbit Polyclonal Antibody
TA332425

USD 275.00

3 Weeks

Rabbit anti-NR0B1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human NR0B1
Nr0b1 Rabbit Polyclonal Antibody
TA332004

USD 375.00

5 Days

Rabbit Polyclonal Anti-Nr0b1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Nr0b1 Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Nr0b1. Synthetic peptide located within the following region: YIEGLQWRTQQILTEHIRMMQREYQIRSAELNSALFLLRFINSDVVTELF