Nr0b1 Rabbit Polyclonal Antibody

CAT#: TA332004

Rabbit Polyclonal Anti-Nr0b1 Antibody

Product Images

WB Suggested Anti-Nr0b1 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Testis

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Nr0b1 Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Nr0b1. Synthetic peptide located within the following region: YIEGLQWRTQQILTEHIRMMQREYQIRSAELNSALFLLRFINSDVVTELF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: nuclear receptor subfamily 0, group B, member 1
• Database Link:
  NP_031456
  Entrez Gene 11614 Mouse
  UniProt ID Q61066
• Background: Nr0b1 is an orphan nuclear receptor and a component of a cascade required for the development of the hypothalamic-pituitary-adrenal-gonadal axis. Nr0b1 acts as a coregulatory protein that inhibits the transcriptional activity of other nuclear receptors through heterodimeric interactions. Nr0b1 may also have a role in the development of the embryo and in the maintenance of embryonic stem cell pluripotency.
• Synonyms: AHC; AHCH; AHX; DAX-1; DAX1; DSS; GTD; HHG; NROB1
• Note: Immunogen sequence homology: Human: 100%; Pig: 92%; Rat: 92%; Mouse: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%; Horse: 83%; Dog: 75%