Antibodies

View as table Download

Rabbit Polyclonal Anti-SEPT2 Antibody

Applications WB
Reactivities Human, Monkey, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SEPT2 antibody: synthetic peptide directed towards the N terminal of human SEPT2. Synthetic peptide located within the following region: MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGK

Rabbit anti-SEPT2 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human SEPT2

Rabbit polyclonal anti-SEPT2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SEPT2.

Goat Anti-SEPT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence SKQQPTQFINPET-C, from the N terminus of the protein sequence according to NP_001008491.1.

Rabbit Polyclonal Anti-SEPT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Full length fusion protein

SEPTIN2 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SEPTIN2