Antibodies

Jump to Filters
View as table Download
ARIH2 Rabbit Polyclonal Antibody
TA344534

USD 475.00

5 Days

Rabbit Polyclonal Anti-ARIH2 Antibody - C-terminal region

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Arih2 antibody is: synthetic peptide directed towards the C-terminal region of Rat Arih2. Synthetic peptide located within the following region: YYMESGPRKKLFEYQQAQLEAEIENLSWKVERADSYDRGDLENQMHIAEQ
ARIH2 Goat Polyclonal Antibody
TA305751

USD 375.00

5 Days

Goat Anti-ARIH2 / TRIAD1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-EQRRRTLLKDFHDT, from the C Terminus of the protein sequence according to NP_006312.1.