ARIH2 Rabbit Polyclonal Antibody

CAT#: TA344534

Rabbit Polyclonal Anti-ARIH2 Antibody - C-terminal region

Product Images

Host: Rabbit; Target Name: Arih2; Sample Tissue: Rat Testis lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Arih2 antibody is: synthetic peptide directed towards the C-terminal region of Rat Arih2. Synthetic peptide located within the following region: YYMESGPRKKLFEYQQAQLEAEIENLSWKVERADSYDRGDLENQMHIAEQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: ariadne RBR E3 ubiquitin protein ligase 2
• Database Link:
  NP_006312
  Entrez Gene 316005 RatEntrez Gene 10425 Human
  UniProt ID O95376
• Background: The function of this protein remains unknown.
• Synonyms: ARI2; TRIAD1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome