Antibodies

Jump to Filters
View as table Download
Ppil3 Rabbit Polyclonal Antibody
TA339877

USD 375.00

5 Days

Rabbit Polyclonal Anti-Ppil3 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ppil3 antibody is: synthetic peptide directed towards the C-terminal region of Rat Ppil3. Synthetic peptide located within the following region: HLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPF