Ppil3 Rabbit Polyclonal Antibody

CAT#: TA339877

Rabbit Polyclonal Anti-Ppil3 Antibody

Product Images

Host: Rabbit; Target Name: Ppil3; Sample Tissue: Rat Thymus lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Ppil3 antibody is: synthetic peptide directed towards the C-terminal region of Rat Ppil3. Synthetic peptide located within the following region: HLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 17 kDa
• Gene Name: peptidylprolyl isomerase like 3
• Database Link:
  NP_783638
  Entrez Gene 301432 Rat
  UniProt ID Q812D3
• Background: Human homolog catalyzes the cis-trans isomerization of peptidylprolyl imide bonds in oligopeptides.
• Synonyms: CyPJ; OTTHUMP00000206159; PPIase; Rotamase
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%