Antibodies

Jump to Filters
View as table Download
PPIL3 Rabbit Polyclonal Antibody
TA339876

USD 375.00

5 Days

Rabbit Polyclonal Anti-PPIL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPIL3 antibody: synthetic peptide directed towards the middle region of human PPIL3. Synthetic peptide located within the following region: NYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVR
Ppil3 Rabbit Polyclonal Antibody
TA339877

USD 375.00

5 Days

Rabbit Polyclonal Anti-Ppil3 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ppil3 antibody is: synthetic peptide directed towards the C-terminal region of Rat Ppil3. Synthetic peptide located within the following region: HLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPF
PPIL3 Rabbit Polyclonal Antibody
TA339878

USD 375.00

5 Days

Rabbit Polyclonal Anti-PPIL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPIL3 antibody: synthetic peptide directed towards the middle region of human PPIL3. Synthetic peptide located within the following region: AGVQWRDLGSLQPPPPGFKQVFCLSLPRTGRGGNSIWGKKFEDEYSEYLK
PPIL3 Mouse Monoclonal Antibody [Clone ID: OTI1G3]
CF505245

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PPIL3 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PPIL3 Mouse Monoclonal Antibody [Clone ID: OTI2E7]
CF505349

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PPIL3 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PPIL3 Mouse Monoclonal Antibody [Clone ID: OTI1D4]
CF505381

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PPIL3 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PPIL3 Mouse Monoclonal Antibody [Clone ID: OTI1G3]
TA505245

USD 379.00

In Stock

PPIL3 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PPIL3 Mouse Monoclonal Antibody [Clone ID: OTI1G3]
TA505245S

USD 159.00

2 Days

PPIL3 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PPIL3 Mouse Monoclonal Antibody [Clone ID: OTI2E7]
TA505349

USD 379.00

In Stock

PPIL3 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PPIL3 Mouse Monoclonal Antibody [Clone ID: OTI2E7]
TA505349S

USD 159.00

2 Days

PPIL3 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PPIL3 Mouse Monoclonal Antibody [Clone ID: OTI1D4]
TA505381

USD 379.00

In Stock

PPIL3 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PPIL3 Mouse Monoclonal Antibody [Clone ID: OTI1D4]
TA505381S

USD 159.00

2 Days

PPIL3 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated