PPIL3 Rabbit Polyclonal Antibody

CAT#: TA339878

Rabbit Polyclonal Anti-PPIL3 Antibody

Product Images

WB Suggested Anti-PPIL3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PPIL3 antibody: synthetic peptide directed towards the middle region of human PPIL3. Synthetic peptide located within the following region: AGVQWRDLGSLQPPPPGFKQVFCLSLPRTGRGGNSIWGKKFEDEYSEYLK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 18 kDa
• Gene Name: peptidylprolyl isomerase like 3
• Database Link:
  NP_115861
  Entrez Gene 53938 Human
  UniProt ID Q9H2H8
• Background: This gene encodes a member of the cyclophilin family. Cyclophilins catalyze the cis-trans isomerization of peptidylprolyl imide bonds in oligopeptides. They have been proposed to act either as catalysts or as molecular chaperones in protein-folding events
• Synonyms: CYPJ
• Note: Immunogen Sequence Homology: Human: 100%