Antibodies

Jump to Filters
View as table Download
AAK1 Rabbit Polyclonal Antibody
TA347740

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-AAK1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-AAK1 Antibody: A synthesized peptide derived from human AAK1
AAK1 Rabbit Polyclonal Antibody
TA315187

USD 345.00

In Stock

Rabbit polyclonal anti-AAK1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AAK1.
AAK1 Rabbit Polyclonal Antibody
TA306661

USD 430.00

5 Days

Rabbit Polyclonal Aak1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Aak1 antibody was raised against a 20 amino acid peptide near the amino terminus of the human Aak1.
AAK1 Rabbit Polyclonal Antibody
TA306656

USD 430.00

5 Days

Rabbit Polyclonal Aak1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Aak1 antibody was raised against a 18 amino acid peptide near the carboxy terminus of the human Aak1.
AAK1 Rabbit Polyclonal Antibody
TA334561

USD 375.00

5 Days

Rabbit Polyclonal Anti-AAK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AAK1 antibody: synthetic peptide directed towards the C terminal of human AAK1. Synthetic peptide located within the following region: SGFDVPEGSDKVAEDEFDPIPVLITKNPQGGHSRNSSGSSESSLPNLARS