Antibodies

Jump to Filters
View as table Download
C9orf98 (AK8) Rabbit Polyclonal Antibody
TA307964

USD 415.00

5 Days

Rabbit Polyclonal antibody to C9orf98 (chromosome 9 open reading frame 98)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 192 and 479 of C9orf98 (Uniprot ID#Q96MA6)
C9orf98 (AK8) Rabbit Polyclonal Antibody
TA338875

USD 375.00

5 Days

Rabbit Polyclonal Anti-AK8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AK8 antibody is: synthetic peptide directed towards the C-terminal region of Human AK8. Synthetic peptide located within the following region: FDSIMERLTLRRIDPVTGERYHLMYKPPPTMEIQARLLQNPKDAEEQVKL
C9orf98 (AK8) Rabbit Polyclonal Antibody
TA373393

USD 220.00

3 Weeks

AK8 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human AK8 (NP_689785.1).
Modifications Unmodified