Rabbit Polyclonal antibody to CaMK1D (calcium/calmodulin-dependent protein kinase ID)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 385 of CaMK1D (Uniprot ID#Q8IU85) |
Rabbit Polyclonal Anti-CAMK1D Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CAMK1D antibody: synthetic peptide directed towards the middle region of human CAMK1D. Synthetic peptide located within the following region: KNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVS |
Rabbit Polyclonal Anti-CAMK1D Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Camk1d antibody is: synthetic peptide directed towards the N-terminal region of Mouse Camk1d. Synthetic peptide located within the following region: LAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIY |
Goat Anti-CAMK1D Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence ASQKDCAYVAKPES, from the C Terminus of the protein sequence according to NP_065130.1. |
Rabbit polyclonal antibody to CAMK1D (calcium/calmodulin-dependent protein kinase ID)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 205 of CaMK1D (Uniprot ID#Q8IU85) |
Rabbit polyclonal antibody to CAMK1D (calcium/calmodulin-dependent protein kinase ID)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 81 and 385 of CAMK1D (Uniprot ID#Q8IU85) |
Rabbit Polyclonal Anti-CAMK1D Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CAMK1D |
CAMK1D rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CAMK1D |
Germany
Japan
United Kingdom
China
