Antibodies

View as table Download

Rabbit Polyclonal Anti-CD226/DNAM-1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CD226/DNAM-1 Antibody: A synthesized peptide derived from human CD226/DNAM-1

Rabbit polyclonal CD226/DNAM-1 (Ab-329) antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human CD226/DNAM-1 around the phosphorylation site of serine 329 (T-F-SP-R-R).

Rabbit Polyclonal Anti-CD226 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD226 antibody is: synthetic peptide directed towards the C-terminal region of Human CD226. Synthetic peptide located within the following region: QASAGENETFVMRLTVAEGKTDNQYTLFVAGGTVLLLLFVISITTIIVIF

Rabbit Polyclonal Anti-CD226 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CD226

CD226 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CD226

CD226 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-254 of human CD226 (NP_006557.2).
Modifications Unmodified