Antibodies

Jump to Filters
View as table Download
ELOVL5 Rabbit Polyclonal Antibody
TA315700

USD 345.00

In Stock

Rabbit polyclonal anti-ELOVL5 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ELOVL5.
ELOVL5 Rabbit Polyclonal Antibody
TA372911

USD 380.00

4 Weeks

ELOVL5 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ELOVL5
ELOVL5 Rabbit Polyclonal Antibody
TA338477

USD 375.00

5 Days

Rabbit Polyclonal Anti-ELOVL5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ELOVL5 antibody: synthetic peptide directed towards the N terminal of human ELOVL5. Synthetic peptide located within the following region: EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK
ELOVL5 Rabbit Polyclonal Antibody
TA590466

USD 409.00

In Stock

Rabbit Polyclonal ELOVL5 Antibody

Applications IF, IHC, WB
Reactivities Human
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
ELOVL5 Rabbit Polyclonal Antibody
TA368678

USD 380.00

4 Weeks

ELOVL5 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ELOVL5
ELOVL5 Rabbit Polyclonal Antibody
TA375869

USD 220.00

3 Weeks

ELOVL5 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 247-326 of human ELOVL5 (NP_001229757.1).
Modifications Unmodified