Antibodies

Jump to Filters
View as table Download
C 4 Methylsterol Oxidase (MSMO1) Rabbit Polyclonal Antibody
TA341859

USD 310.00

5 Days

Rabbit Polyclonal Anti-SC4MOL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SC4MOL antibody: synthetic peptide directed towards the N terminal of human SC4MOL. Synthetic peptide located within the following region: MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA
C 4 Methylsterol Oxidase (MSMO1) Rabbit Polyclonal Antibody
TA351165

USD 345.00

In Stock

Rabbit Polyclonal Anti-MSMO1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MSMO1
MSMO1 Rabbit Polyclonal Antibody
TA367047

USD 380.00

4 Weeks

MSMO1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human MSMO1