C 4 Methylsterol Oxidase (MSMO1) Rabbit Polyclonal Antibody

CAT#: TA341859

Rabbit Polyclonal Anti-SC4MOL Antibody

Product Images

WB Suggested Anti-SC4MOL Antibody Titration: 5.0 ug/ml; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SC4MOL antibody: synthetic peptide directed towards the N terminal of human SC4MOL. Synthetic peptide located within the following region: MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: methylsterol monooxygenase 1
• Database Link:
  NP_006736
  Entrez Gene 6307 Human
  UniProt ID Q15800
• Background: Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity toThe yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases.The protein is localized toThe endoplasmic reticulum membrane and is believed to function in cholesterol biosynthesis. Alternatively spliced transcript variants encoding distinct isoforms have been found forThis gene. [provided by RefSeq, Jul 2008]
• Synonyms: DESP4; ERG25; MCCPD; SC4MOL
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 79%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Metabolic pathways, Steroid biosynthesis