Antibodies

View as table Download

PIEZO2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PIEZO2

Rabbit Polyclonal Anti-PIEZO2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIEZO2 antibody is: synthetic peptide directed towards the N-terminal region of Human PIEZO2. Synthetic peptide located within the following region: VFGFWAFGKHSAAADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRK

Rabbit Polyclonal Anti-PIEZO2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIEZO2antibody: synthetic peptide directed towards the middle region of human FAM38B. Synthetic peptide located within the following region: AGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMDITIILS

Rabbit Polyclonal Anti-PIEZO2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen PIEZO2 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human PIEZO2.

PIEZO2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PIEZO2