Rabbit Polyclonal Anti-RMDN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RMDN2 antibody: synthetic peptide directed towards the middle region of human RMDN2. Synthetic peptide located within the following region: WRFARAYGDMYELSTNTQEKKHYANIGKTLSERAINRAPMNGHCHLWYAV |
Rabbit Polyclonal Anti-RMDN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RMDN2 antibody: synthetic peptide directed towards the middle region of human RMDN2. Synthetic peptide located within the following region: RAPMNGHCHLWYAVLCGYVSEFEGLQNKINYGHLFKEHLDIAIKLLPEEP |
RMDN2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RMDN2 |
Germany
Japan
United Kingdom
China
