TAAR2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TAAR2 |
TAAR2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TAAR2 |
GPR58 / TAAR2 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | TAAR2 / GPR58 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human TAAR2. Percent identity with other species by BLAST analysis: Human (100%); Marmoset (83%). |
Rabbit polyclonal TAAR2 Antibody (N-term)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This TAAR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human TAAR2. |
Rabbit Polyclonal Anti-TAAR2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TAAR2 antibody is: synthetic peptide directed towards the C-terminal region of Human TAAR2. Synthetic peptide located within the following region: ENQNNQVKKDKKAAKTLGIVIGVFLLCWFPCFFTILLDPFLNFSTPVVLF |
TAAR2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TAAR2 |