Antibodies

View as table Download

USP16 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human USP16

Rabbit anti-USP16 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat, Monkey
Conjugation Unconjugated
Immunogen Recombinant protein of human USP16

Rabbit Polyclonal Anti-USP16 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-USP16 antibody: synthetic peptide directed towards the N terminal of human USP16. Synthetic peptide located within the following region: CKTDNKVKDKAEEETEEKPSVWLCLKCGHQGCGRNSQEQHALKHYLTPRS

USP16 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human USP16