Rabbit Polyclonal Anti-ACER1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACER1 antibody: synthetic peptide directed towards the C terminal of human ACER1. Synthetic peptide located within the following region: VNAYALNSIALHILYIVCQEYRKTSNKELRHLIEVSVVLWAVALTSWISD |
Rabbit polyclonal anti-ACER1 (ASAH3) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ASAH3. |
Rabbit Polyclonal Anti-ACER1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACER1 antibody: synthetic peptide directed towards the C terminal of human ACER1. Synthetic peptide located within the following region: ITFPYGMVTMALVDANYEMPGETLKVRYWPRDSWPVGLPYVEIRGDDKDC |
ACER1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACER1 |
ASAH3 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthesized peptide derived from ASAH3 . at AA range: 100-180 |
Germany
Japan
United Kingdom
China
