ASAH3 (ACER1) Rabbit Polyclonal Antibody

CAT#: TA343069

Rabbit Polyclonal Anti-ACER1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ACER1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human, Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ACER1 antibody: synthetic peptide directed towards the C terminal of human ACER1. Synthetic peptide located within the following region: VNAYALNSIALHILYIVCQEYRKTSNKELRHLIEVSVVLWAVALTSWISD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 31 kDa
Gene Name alkaline ceramidase 1
Background ACER1 hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid at an optimal pH of 8.0. It has a highly restricted substrate specificity for the natural stereoisomer of ceramide with D-erythro-sphingosine but not D-ribo-phytosphingosine or D-erythro-dihydrosphingosine as a backbone. It may have a role in regulating the levels of bioactive lipids ceramide and sphingosine 1-phosphate, as well as complex sphingolipids.
Synonyms ALKCDase1; ASAH3
Note Immunogen Sequence Homology: Human: 100%; Dog: 92%; Rabbit: 86%; Pig: 85%; Bovine: 79%; Rat; Guinea pig: 75%
Reference Data
Protein Families Transmembrane
Protein Pathways Metabolic pathways, Sphingolipid metabolism

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.