Antibodies

View as table Download

Rabbit polyclonal AKAP8 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AKAP8.

Rabbit Polyclonal AKAP95/AKAP8 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH-conjugated human AKAP95 peptide within amino acids 650 to 692 [Swiss-Prot# O43823].

Rabbit Polyclonal Anti-AKAP8 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-AKAP8 Antibody: A synthesized peptide derived from human AKAP8

Goat Polyclonal Antibody against AKAP8

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence DQGYGGYGAWSAG-C, from the N Terminus of the protein sequence according to NP_005849.

Rabbit Polyclonal anti-AKAP8 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AKAP8 antibody: synthetic peptide directed towards the middle region of human AKAP8. Synthetic peptide located within the following region: DVLAEVITAAVRAVDGEGAPAPESSGEPAEDEGPTDTAEAGSDPQAEQLL

Rabbit Polyclonal Anti-AKAP8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AKAP8 antibody: synthetic peptide directed towards the middle region of human AKAP8. Synthetic peptide located within the following region: YLKGEDPFTSETVDPEMEGDDNLGGEDKKETPEEVAADVLAEVITAAVRA

Rabbit Polyclonal Anti-AKAP8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AKAP8 antibody: synthetic peptide directed towards the middle region of human AKAP8. Synthetic peptide located within the following region: CKFRSFDDEEIQKHLQSKFHKETLRFISTKLPDKTVEFLQEYIVNRNKKI

Anti-AKAP8 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 679-691 amino acids of human A kinase (PRKA) anchor protein 8

Anti-AKAP8 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 679-691 amino acids of human A kinase (PRKA) anchor protein 8

AKAP8 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human AKAP8
Modifications Unmodified

AKAP8 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 480-692 of human AKAP8 (NP_005849.1).
Modifications Unmodified