Antibodies

View as table Download

Rabbit Polyclonal Aldh5A1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Aldh5A1 antibody was raised against a 22 amino acid peptide near the carboxy terminus of the human Aldh5A1.

Rabbit Polyclonal Anti-ALDH5A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH5A1 antibody: synthetic peptide directed towards the middle region of human ALDH5A1. Synthetic peptide located within the following region: AFFLEWFSEEARRVYGDIIHTPAKDRRALVLKQPIGVAAVITPWNFPSAM

Anti-ALDH5A1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 514-529 amino acids of human aldehyde dehydrogenase 5 family, member A1

Anti-ALDH5A1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 514-529 amino acids of human aldehyde dehydrogenase 5 family, member A1

ALDH5A1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human ALDH5A1 (NP_001071.1).
Modifications Unmodified