Antibodies

Jump to Filters
View as table Download
ASCL4 Rabbit Polyclonal Antibody
TA339845

USD 375.00

5 Days

Rabbit Polyclonal Anti-ASCL4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASCL4 antibody: synthetic peptide directed towards the N terminal of human ASCL4. Synthetic peptide located within the following region: METRKPAERLALPYSLRTAPLGVPGTLPGLPRRDPLRVALRLDAACWEWA
ASCL4 Rabbit Polyclonal Antibody
TA373730

USD 220.00

3 Weeks

ASCL4 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-172 of human ASCL4 (NP_982260.2).
Modifications Unmodified