CORO1B rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CORO1B |
CORO1B rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CORO1B |
Rabbit Polyclonal antibody to Coronin 1B (coronin, actin binding protein, 1B)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 213 of Coronin 1B (Uniprot ID#Q9BR76) |
Rabbit Polyclonal Anti-CORO1B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CORO1B Antibody is: synthetic peptide directed towards the C-terminal region of Human CORO1B. Synthetic peptide located within the following region: STTTAADATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQ |
CORO1B rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CORO1B |
CORO1B Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 380-489 of human CORO1B (NP_065174.1). |
Modifications | Unmodified |