Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against CSNK1E
| Applications | WB |
| Reactivities | Human |
| Immunogen | Peptide with sequence C-PASQTSVPFDHLGK, from the C Terminus of the protein sequence according to NP_001885.1; NP_689407.1. |
Rabbit Polyclonal Anti-CSNK1E Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-CSNK1E antibody: synthetic peptide directed towards the N terminal of human CSNK1E. Synthetic peptide located within the following region: MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLH |
Rabbit Polyclonal Anti-CSNK1E Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CSNK1E |
CSNK1E rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CSNK1E |
CSNK1E Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 247-416 of human CSNK1E (NP_689407.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CSNK1E
Isotypes
- IgG