CK1 epsilon (CSNK1E) Rabbit Polyclonal Antibody

CAT#: TA340032

Rabbit Polyclonal Anti-CSNK1E Antibody

Product Images

WB Suggested Anti-CSNK1E Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CSNK1E antibody: synthetic peptide directed towards the N terminal of human CSNK1E. Synthetic peptide located within the following region: MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: casein kinase 1 epsilon
• Database Link:
  NP_001885
  Entrez Gene 1454 Human
• Background: Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. CSNK1E can phosphorylate a large number of proteins. CSNK1E participates in Wnt signaling and is the central component of the circadian clock. It may act as a negative regulator of circadian rhythmicity by phosphorylating PER1 and PER2. CSNK1E inhibits cytokine-induced granuloytic differentiation.The protein encoded by this gene is a serine/threonine protein kinase and a member of the casein kinase I protein family, whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. The encoded protein is found in the cytoplasm as a monomer and can phosphorylate a variety of proteins, including itself. This protein has been shown to phosphorylate period, a circadian rhythm protein. Two transcript variants encoding the same protein have been found for this gene.
• Synonyms: CKIepsilon; HCKIE
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Yeast: 93%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Circadian rhythm - mammal, Hedgehog signaling pathway, Wnt signaling pathway