Rabbit Polyclonal CUEDC2 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CUEDC2 antibody was raised against a 19 amino acid peptide from near the carboxy terminus of human CUEDC2. |
Rabbit Polyclonal CUEDC2 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CUEDC2 antibody was raised against a 19 amino acid peptide from near the carboxy terminus of human CUEDC2. |
Anti-CUEDC2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.262~266(D-V-R-N-P) derived from Human CUEDC2. |
Rabbit Polyclonal Anti-CUEDC2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cuedc2 antibody is: synthetic peptide directed towards the middle region of Mouse Cuedc2. Synthetic peptide located within the following region: IPRGIIGDMMQKLSVQLSDARNKENLHPQSSCVQGQVPIFPETPRQAEKL |
Rabbit Polyclonal Anti-CUEDC2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CUEDC2 |
CUEDC2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CUEDC2 |
CUEDC2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human CUEDC2 (NP_076945.2). |
Modifications | Unmodified |