Rabbit Polyclonal Anti-DCUN1D1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCUN1D1 antibody: synthetic peptide directed towards the N terminal of human DCUN1D1. Synthetic peptide located within the following region: SQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENK |
Rabbit Polyclonal anti-DCUN1D1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCUN1D1 antibody: synthetic peptide directed towards the middle region of human DCUN1D1. Synthetic peptide located within the following region: PKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTT |
DCUN1D1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 15-70 of human DCUN1D1 (NP_065691.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
