Antibodies

Jump to Filters
View as table Download
DDT Rabbit Polyclonal Antibody
TA371863

USD 380.00

4 Weeks

DDT rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human DDT
DDT Rabbit Polyclonal Antibody
TA308199

USD 415.00

5 Days

Rabbit polyclonal antibody to DDT (D-dopachrome tautomerase)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 118 of DDT (Uniprot ID#P30046)
DDT Rabbit Polyclonal Antibody
TA338989

USD 375.00

5 Days

Rabbit Polyclonal Anti-DDT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDT antibody: synthetic peptide directed towards the N terminal of human DDT. Synthetic peptide located within the following region: PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALS
DDT Rabbit Polyclonal Antibody
TA367627

USD 380.00

4 Weeks

DDT rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human DDT
DDT Rabbit Polyclonal Antibody
TA375380

USD 220.00

3 Weeks

DDT Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human DDT (NP_001346.1).
Modifications Unmodified