Rabbit Polyclonal Anti-EEF2 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EEF2 antibody: synthetic peptide directed towards the N terminal of human EEF2. Synthetic peptide located within the following region: TDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSEND |
EEF2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human EEF2 |
eEF2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-290 of human eEF2 (NP_001952.1). |
| Modifications | Unmodified |
Phospho-eEF2-T56 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around T56 of human Phospho-eEF2-T56 (NP_001952.1). |
| Modifications | Phospho T56 |
Elongation factor 2 Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human EEF2 |
EEF2 (phospho-T56) polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 20-70 of Human eEF2. |
Germany
Japan
United Kingdom
China
