Antibodies

Jump to Filters
View as table Download
Thrombin Receptor (F2R) Goat Polyclonal Antibody
TA305911

USD 375.00

In Stock

Goat Anti-F2R / PAR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TRARRPESKATNAT, from the Internal region (near N-terminus) of the protein sequence according to NP_001983.2.
Thrombin Receptor (F2R) Rabbit Polyclonal Antibody
TA347480

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Thrombin Receptor Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Thrombin Receptor Antibody: A synthesized peptide derived from human Thrombin Receptor
Thrombin Receptor (F2R) Rabbit Polyclonal Antibody
TA313854

USD 345.00

In Stock

Rabbit polyclonal Thrombin Receptor antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Thrombin Receptor.
Thrombin Receptor (F2R) Rabbit Polyclonal Antibody
TA313855

USD 345.00

In Stock

Rabbit polyclonal F2R / PAR1 (Cleaved-Ser42) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human PAR1.
Thrombin Receptor (F2R) Rabbit Polyclonal Antibody
TA590107

USD 409.00

In Stock

Rabbit Polyclonal Thrombin Receptor Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. In vivo generated recombinant protein fragment.
Thrombin Receptor (F2R) Rabbit Polyclonal Antibody
TA339927

USD 375.00

5 Days

Rabbit Polyclonal Anti-F2R Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F2R antibody: synthetic peptide directed towards the N terminal of human F2R.
Thrombin Receptor (F2R) Rabbit Polyclonal Antibody
TA342827

USD 375.00

5 Days

Rabbit Polyclonal Anti-F2R Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F2R antibody: synthetic peptide directed towards the C terminal of human F2R. Synthetic peptide located within the following region: YAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSSAVANRSKKSRALFLSA
Thrombin Receptor (F2R) Rabbit Polyclonal Antibody
TA321415

USD 345.00

In Stock

Anti-F2R Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 56-70 amino acids of human coagulation factor II (thrombin) receptor
Thrombin Receptor (F2R) Rabbit Polyclonal Antibody
TA321416

USD 345.00

4 Weeks

Anti-F2R Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 56-70 amino acids of human coagulation factor II (thrombin) receptor
Thrombin Receptor (F2R) Rabbit Polyclonal Antibody
TA376059

USD 220.00

3 Weeks

F2R Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 42-110 of human F2R (NP_001983.2).
Modifications Unmodified