Antibodies

Jump to Filters
View as table Download
Mitochondrial Ferritin (FTMT) Rabbit Polyclonal Antibody
TA331204

USD 375.00

5 Days

Rabbit Polyclonal Anti-FTMT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FTMT antibody is: synthetic peptide directed towards the middle region of Human FTMT. Synthetic peptide located within the following region: AYYFSRDDVALNNFSRYFLHQSREETEHAEKLMRLQNQRGGRIRLQDIKK
Mitochondrial Ferritin (FTMT) Rabbit Polyclonal Antibody
TA376369

USD 220.00

3 Weeks

FTMT Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 183-242 of human FTMT (NP_803431.1).
Modifications Unmodified