Mitochondrial Ferritin (FTMT) Rabbit Polyclonal Antibody

CAT#: TA331204

Rabbit Polyclonal Anti-FTMT Antibody

Product Images

WB Suggested Anti-FTMT Antibody; Titration: 1.0 ug/ml; Positive Control: Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FTMT antibody is: synthetic peptide directed towards the middle region of Human FTMT. Synthetic peptide located within the following region: AYYFSRDDVALNNFSRYFLHQSREETEHAEKLMRLQNQRGGRIRLQDIKK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: ferritin mitochondrial
• Database Link:
  NP_803431
  Entrez Gene 94033 Human
  UniProt ID Q8N4E7
• Background: FTMT stores iron in a soluble, non-toxic, readily available form. FTMT is important for iron homeostasis and has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation.
• Synonyms: MTF
• Note: Human: 100%; Pig: 93%; Rat: 93%; Rabbit: 93%; Horse: 90%; Dog: 86%; Mouse: 86%; Bovine: 86%; Guinea pig: 86%; Goat: 85%; Sheep: 85%; Zebrafish: 79%

Reference Data

• Protein Pathways: Porphyrin and chlorophyll metabolism