Antibodies

Jump to Filters
View as table Download
GNPDA1 Rabbit Polyclonal Antibody
TA346600

USD 475.00

5 Days

Rabbit Polyclonal Anti-GNPDA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNPDA1 antibody: synthetic peptide directed towards the C terminal of human GNPDA1. Synthetic peptide located within the following region: EGVNHMWTVSAFQQHPRTVFVCDEDATLELKVKTVKYFKGLMLVHNKLVD
GNPDA1 Rabbit Polyclonal Antibody
TA306732

USD 430.00

5 Days

Rabbit Polyclonal GNPDA1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GNPDA1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human GNPDA1.