Antibodies

Jump to Filters
View as table Download
MAG1 (GPAT3) Rabbit Polyclonal Antibody
TA315936

USD 345.00

In Stock

Rabbit polyclonal anti-AGPAT9 (MAG1/PLCH) antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human PLCH.
MAG1 (GPAT3) Rabbit Polyclonal Antibody
TA347619

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-PLCH Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PLCH Antibody: A synthesized peptide derived from human PLCH
Gpat3 Rabbit Polyclonal Antibody
TA339622

USD 375.00

5 Days

Rabbit Polyclonal Anti-Agpat9 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Agpat9 antibody is: synthetic peptide directed towards the middle region of Rat Agpat9. Synthetic peptide located within the following region: HGGLMGIIQRAMVKACPHVWFERSEIKDRHLVTKRLKEHIADKKKLPILI
MAG1 (GPAT3) Rabbit Polyclonal Antibody
TA351369

USD 345.00

In Stock

Rabbit Polyclonal Anti-AGPAT9 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human AGPAT9
GPAT3 Rabbit Polyclonal Antibody
TA367126

USD 380.00

4 Weeks

GPAT3 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPAT3