Antibodies

Jump to Filters
View as table Download
IL16 Rabbit Polyclonal Antibody
TA372366

USD 380.00

4 Weeks

IL16 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL16
IL16 Rabbit Polyclonal Antibody
TA327169

USD 275.00

3 Weeks

Rabbit anti-IL16 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human IL16
IL16 Rabbit Polyclonal Antibody
TA306708

USD 430.00

5 Days

Rabbit Polyclonal IL-16 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IL-16 antibody was raised against a 20 amino acid peptide near the amino terminus of human IL-16.
IL16 Rabbit Polyclonal Antibody
TA306713

USD 430.00

5 Days

Rabbit Polyclonal IL-16 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IL-16 antibody was raised against a 14 amino acid peptide near the amino terminus of human IL-16.
IL16 Rabbit Polyclonal Antibody
TA590184

USD 409.00

In Stock

Rabbit Polyclonal IL16 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
IL16 Rabbit Polyclonal Antibody
TA308824

USD 415.00

5 Days

Rabbit polyclonal antibody to IL16 (interleukin 16 (lymphocyte chemoattractant factor))

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1268 and 1332 of IL16 (Uniprot ID#Q14005)
IL16 Rabbit Polyclonal Antibody
TA328235

USD 285.00

5 Days

Anti-Human IL-16 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-16 (129 a.a.)
IL16 Rabbit Polyclonal Antibody
TA328234

USD 285.00

5 Days

Biotinylated Anti-Human IL-16 Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-16 (129 a.a.)
IL16 Rabbit Polyclonal Antibody
TA343142

USD 375.00

5 Days

Rabbit Polyclonal Anti-IL16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL16 antibody is: synthetic peptide directed towards the C-terminal region of Human IL16. Synthetic peptide located within the following region: EILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAGDS