Rabbit polyclonal anti-KCND1 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human KCND1. |
Rabbit polyclonal anti-KCND1 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human KCND1. |
Rabbit Polyclonal Anti-Kcnd1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Kcnd1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MAAGVATWLPFARAAAVGWLPLAQQPLPPAPEVKASRGDEVLVVNVSGRR |
Rabbit Polyclonal Anti-KCND1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCND1 |
KCND1 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCND1 |
KCND1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 488-647 of human KCND1 (NP_004970.3). |
Modifications | Unmodified |