Antibodies

View as table Download

Rabbit Polyclonal Anti-KIF2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIF2A antibody: synthetic peptide directed towards the middle region of human KIF2A. Synthetic peptide located within the following region: DSYATQLEAILEQKIDILTELRDKVKSFRAALQEEEQASKQINPKRPRAL

Rabbit Polyclonal Anti-KIF2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIF2A antibody: synthetic peptide directed towards the N terminal of human KIF2A. Synthetic peptide located within the following region: IEPSPETPPPPASSAKVNKIVKNRRTVASIKNDPPSRDNRVVGSARARPS

Rabbit Polyclonal Anti-KIF2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIF2A antibody: synthetic peptide directed towards the C terminal of human KIF2A. Synthetic peptide located within the following region: ETQWGVGSSPQRDDLKLLCEQNEEEVSPQLFTFHEAVSQMVEMEEQVVED

Rabbit Polyclonal Anti-KIF2A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KIF2A

KIF2A rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KIF2A

KIF2A rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KIF2A

KIF2A rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KIF2A

KIF2A Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-220 of human KIF2A (NP_004511.2).
Modifications Unmodified