Rabbit Polyclonal Anti-Keratin 16 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Keratin 16 Antibody: A synthesized peptide derived from human Keratin 16 |
Rabbit Polyclonal Anti-Keratin 16 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Keratin 16 Antibody: A synthesized peptide derived from human Keratin 16 |
Rabbit polyclonal Keratin 16 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Keratin 16. |
Rabbit Polyclonal Anti-KRT16 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KRT16 antibody: synthetic peptide directed towards the middle region of human KRT16. Synthetic peptide located within the following region: IAATIENAQPILQIDNARLAADDFRTKYEHELALRQTVEADVNGLRRVLD |
Rabbit Polyclonal Anti-KRT16 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KRT16 antibody: synthetic peptide directed towards the middle region of human KRT16. Synthetic peptide located within the following region: LRKNHEEEMLALRGQTGGDVNVEMDAAPGVDLSRILNEMRDQYEQMAEKN |
Rabbit Polyclonal Anti-Keratin 16 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Keratin 16 Antibody: A synthesized peptide derived from human Keratin 16 |
Anti-KRT16 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 195-212 amino acids of Human Keratin, type I cytoskeletal 16 |
Anti-KRT16 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 195-212 amino acids of Human Keratin, type I cytoskeletal 16 |
Cytokeratin 16 (KRT16) Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 190-430 of human Cytokeratin 16 (KRT16) (NP_005548.2). |
Modifications | Unmodified |