Antibodies

View as table Download

Rabbit polyclonal NPAS2 Antibody (N-term)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This NPAS2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human NPAS2.

Rabbit Polyclonal Anti-NPAS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NPAS2 Antibody: synthetic peptide directed towards the N terminal of human NPAS2. Synthetic peptide located within the following region: MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLE

Rabbit Polyclonal Anti-NPAS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NPAS2 Antibody: synthetic peptide directed towards the C terminal of human NPAS2. Synthetic peptide located within the following region: DSLLLSTYSQQPGTLGYPQPPPAQPQPLRPPRRVSSLSESSGLQQPPR

Rabbit Polyclonal Anti-Npas2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Npas2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PLQPAQAQQQPPPYLQAPTSLHSEQPDSLLLSTFSQQPGTLGYAATQSTP

Rabbit Polyclonal Anti-Npas2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Npas2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VSYADVRVERRQELALEDPPTEAMHPSAVKEKDSSLEPPQPFNALDMGAS

NPAS2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human NPAS2.