Npas2 Rabbit Polyclonal Antibody

CAT#: TA341805

Rabbit Polyclonal Anti-Npas2 Antibody

Product Images

WB Suggested Anti-Npas2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Mouse Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Npas2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VSYADVRVERRQELALEDPPTEAMHPSAVKEKDSSLEPPQPFNALDMGAS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 91 kDa
• Gene Name: neuronal PAS domain protein 2
• Database Link:
  NP_032745
  Entrez Gene 18143 Mouse
  UniProt ID P97460
• Background: BMAL1-NPAS2 heterodimers activate E-box element (3'-CACGTG-5') transcription of a number of proteins ofThe circadian clock.This transcription is inhibited in a feedback loop by PER, and also by CRY proteins.
• Synonyms: bHLHe9; FLJ23138; MGC71151; MOP4; PASD4
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 92%; Bovine: 85%; Pig: 77%