Npas2 Rabbit Polyclonal Antibody

CAT#: TA341805

Rabbit Polyclonal Anti-Npas2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Npas2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Npas2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VSYADVRVERRQELALEDPPTEAMHPSAVKEKDSSLEPPQPFNALDMGAS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 91 kDa
Gene Name neuronal PAS domain protein 2
Background BMAL1-NPAS2 heterodimers activate E-box element (3'-CACGTG-5') transcription of a number of proteins ofThe circadian clock.This transcription is inhibited in a feedback loop by PER, and also by CRY proteins.
Synonyms bHLHe9; FLJ23138; MGC71151; MOP4; PASD4
Note Immunogen Sequence Homology: Mouse: 100%; Rat: 92%; Bovine: 85%; Pig: 77%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.