Antibodies

Jump to Filters
View as table Download
FAM55D (NXPE4) Rabbit Polyclonal Antibody
TA335937

USD 310.00

5 Days

Rabbit Polyclonal Anti-FAM55D Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FAM55D Antibody: synthetic peptide directed towards the C terminal of human FAM55D. Synthetic peptide located within the following region: TYSVKEMEYLTRAIDRTGGEKNTVIVISLGQHFRPFPIDVFIRRALNVHK
FAM55D (NXPE4) Rabbit Polyclonal Antibody
TA335938

USD 375.00

5 Days

Rabbit Polyclonal Anti-Fam55d Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Fam55d Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NSDVERFSDFHGYTQYLALKDIFQDLNVGVIDAWDMTVAYGINNVHPPED