FAM55D (NXPE4) Rabbit Polyclonal Antibody

CAT#: TA335937

Rabbit Polyclonal Anti-FAM55D Antibody

Product Images

WB Suggested Anti-FAM55D Antibody Titration: 5.0 ug/ml; Positive Control: Jurkat cell lysate

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FAM55D Antibody: synthetic peptide directed towards the C terminal of human FAM55D. Synthetic peptide located within the following region: TYSVKEMEYLTRAIDRTGGEKNTVIVISLGQHFRPFPIDVFIRRALNVHK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: neurexophilin and PC-esterase domain family member 4
• Database Link:
  NP_001071107
  Entrez Gene 54827 Human
  UniProt ID Q6UWF7
• Background: The function remains unknown.
• Synonyms: C11orf33; FAM55D
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Secreted Protein, Transmembrane