Rabbit polyclonal anti-OR4E2 antibody
Applications | IF |
Reactivities | Human |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR4E2. |
Rabbit polyclonal anti-OR4E2 antibody
Applications | IF |
Reactivities | Human |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR4E2. |
Rabbit Polyclonal Anti-OR4E2 Antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for Anti-OR4E2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR4E2. Synthetic peptide located within the following region: RPDTSFSIDKVVSVFYTVVTPLLNPFIYTLRNEEVKSAMKQLRQRQVFFT |