Antibodies

View as table Download

Rabbit Polyclonal Anti-OTX2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OTX2 antibody: synthetic peptide directed towards the N terminal of human OTX2. Synthetic peptide located within the following region: PESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGT

Rabbit anti-OTX2 Polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human OTX2

Rabbit monoclonal antibody against OTX2(clone EPR3348)

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Otx2 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit Polyclonal anti-OTX2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OTX2 antibody: synthetic peptide directed towards the middle region of human OTX2. Synthetic peptide located within the following region: NGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSI

Rabbit Polyclonal Anti-OTX2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OTX2 antibody: synthetic peptide directed towards the middle region of human OTX2. Synthetic peptide located within the following region: QQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPV