OTX2 Rabbit Polyclonal Antibody

CAT#: TA329270

Rabbit Polyclonal anti-OTX2 antibody

Product Images

WB Suggested Anti-OTX2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-OTX2 antibody: synthetic peptide directed towards the middle region of human OTX2. Synthetic peptide located within the following region: NGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: orthodenticle homeobox 2
• Database Link:
  NP_068374
  Entrez Gene 5015 Human
  UniProt ID P32243
• Background: Homeobox protein OTX2 is a member of the bicoid sub-family of homeodomain-containing transcription factors. This protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper forebrain development. Two transcript variants encoding distinct isoforms have been identified for this gene. Other alternative splice variants may exist, but their full length sequences have not been determined.This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper forebrain development. Two transcript variants encoding distinct isoforms have been identified for this gene. Other alternative splice variants may exist, but their full length sequences have not been determined.
• Synonyms: CPHD6; MCOPS5
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 92%

Reference Data

• Protein Families: Embryonic stem cells, Induced pluripotent stem cells, Stem cell - Pluripotency, Transcription Factors