Rabbit Polyclonal Anti-POFUT2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POFUT2 antibody: synthetic peptide directed towards the C terminal of human POFUT2. Synthetic peptide located within the following region: RFEPTWEELELYKDGGVAIIDQWICAHARCLPTSLSAESGSGGFQRFFCP |
Rabbit Polyclonal Anti-POFUT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POFUT2 antibody: synthetic peptide directed towards the N terminal of human POFUT2. Synthetic peptide located within the following region: GAASRRRYLLYDVNPPEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWG |
POFUT2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 240-370 of human POFUT2 (NP_056042.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
